"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7M9J4"	"{'domain_architectures': 6848, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6848}"	"['Member of a network of 50S ribosomal subunit biogenesis factors which assembles along the 30S-50S interface, preventing incorrect 23S rRNA structures from forming. Promotes peptidyl transferase center (PTC) maturation']"	"darP"	""	"DARP_ECO8A"	"6a8cedc71676e2bbe6dd350c3e9c649fa1bf0740"	True	False	False	183	"Dual-action ribosomal maturation protein DarP"	3	""	"MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG"	"reviewed"	"{'taxId': '585034', 'scientificName': 'Escherichia coli O8 (strain IAI1)', 'fullName': 'Escherichia coli O8 (strain IAI1)'}"
