"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7L9W3"	"{'domain_architectures': 24758, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 24758}"	"['The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II complex composed of GatA, GatB and GatC is involved in galactitol transport']"	"gatB"	"[{'identifier': 'GO:0008982', 'name': 'protein-N(PI)-phosphohistidine-sugar phosphotransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009401', 'name': 'phosphoenolpyruvate-dependent sugar phosphotransferase system', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B7L9W3_ECO55"	"f3070428690adfd707457974133a19038f9498ce"	True	False	False	94	"PTS system galactitol-specific EIIB component"	4	"UP000000746"	"MKRKIIVACGGAVATSTMAAEEIKELCQNHNIPVELIQCRVNEIETYMDGVHLICTTAKVDRSFGDIPLVHGMPFISGVGIEALQNKILTILQG"	"unreviewed"	"{'taxId': '585055', 'scientificName': 'Escherichia coli (strain 55989 / EAEC)', 'fullName': 'Escherichia coli (strain 55989 / EAEC)'}"