"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7KJ51"	"{'domain_architectures': 44517, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 44517}"	"['NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration']"	"ndhK"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NDHK_GLOC7"	"ec2bdf213efa2e994a9300f4d128e854c4d858c2"	True	False	False	247	"NAD(P)H-quinone oxidoreductase subunit K"	3	"UP000002384"	"MSPNLTSSSDLFTQEQKEKLLNPINHSQVTQDLSENVILTTVDDLYNWARLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLIITAGTITMKMAPALVRLYEQMPDPKYVIAMGACTITGGMFSSDSTTAVRGVDKLIPVDVYIPGCPPRPEAIFDAIVKLRKKVANDSIQVRPEQNHRYYSTTHTMKATSPILTGQYLRAQTRQAPPLELSEAMGMPIPPALMTTEQKEEVDRG"	"reviewed"	"{'taxId': '65393', 'scientificName': 'Gloeothece citriformis (strain PCC 7424)', 'fullName': 'Gloeothece citriformis (strain PCC 7424)'}"
