"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7JJD6"	"{'domain_architectures': 21330, 'entries': 21, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 4, 'ssf': 1, 'pfam': 4, 'smart': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21330}"	"['May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO']"	"recR"	"[{'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006310', 'name': 'DNA recombination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RECR_BACC0"	"ce01ad59a6925878e860e8dcc06379ca41da7ed2"	True	False	False	198	"Recombination protein RecR"	3	""	"MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"	"reviewed"	"{'taxId': '405535', 'scientificName': 'Bacillus cereus (strain AH820)', 'fullName': 'Bacillus cereus (strain AH820)'}"
