"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7H9J0"	"{'domain_architectures': 136430, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 136430}"	"[""Purine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines hypoxanthine and guanine to form the corresponding ribonucleotides IMP (inosine 5'-monophosphate) and GMP (guanosine 5'-monophosphate), with the release of PPi""]"	"hpt2"	"[{'identifier': 'GO:0004422', 'name': 'hypoxanthine phosphoribosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006166', 'name': 'purine ribonucleoside salvage', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B7H9J0_BACC4"	"0f8ac38f062a402c09070bf5cbec330fb03fbefd"	True	False	False	175	"Hypoxanthine phosphoribosyltransferase"	3	""	"MNIEIKDTLISEEQLQAKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVVTE"	"unreviewed"	"{'taxId': '405532', 'scientificName': 'Bacillus cereus (strain B4264)', 'fullName': 'Bacillus cereus (strain B4264)'}"