"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7GW13"	"{'domain_architectures': 24612, 'entries': 17, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'ssf': 1, 'cdd': 1, 'pfam': 2, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 24612}"	"[""One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit"", 'One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit']"	"rplX"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL24_ACIB3"	"d854018fe39984f1491ee44f0dd592ce9956254a"	True	False	False	105	"Large ribosomal subunit protein uL24"	3	""	"MAKIKKGDQVIVIAGKEKGKQGTVLSVSEDRVKVEGLNLVKKHQKPNRVTGAEGGIVTQEASLHISNVAILNATTQKADRVGYQVIDGVKTRVYKSTGESVAVAK"	"reviewed"	"{'taxId': '557600', 'scientificName': 'Acinetobacter baumannii (strain AB307-0294)', 'fullName': 'Acinetobacter baumannii (strain AB307-0294)'}"
