"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7GGU7"	"{'domain_architectures': 10174, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10174}"	"['Catalyzes the decarboxylation of S-adenosylmethionine to S-adenosylmethioninamine (dcAdoMet), the propylamine donor required for the synthesis of the polyamines spermine and spermidine from the diamine putrescine']"	"speH"	"[{'identifier': 'GO:0004014', 'name': 'adenosylmethionine decarboxylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008295', 'name': 'spermidine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SPEH_ANOFW"	"e627e0db2208c2b254f5a0d428806d72cc7f9dd3"	True	False	False	124	"S-adenosylmethionine decarboxylase proenzyme"	3	""	"MDTMGRHVISELWGCDFDKLNDMEFIEKTFVDAALKSGAEIREVAFHKFAPQGVSGVVIISESHLTIHSFPEHGYASIDVYTCGHLDPTIAADYIAEALGAQTRETIELPRGMGPIEIKQAKAL"	"reviewed"	"{'taxId': '491915', 'scientificName': 'Anoxybacillus flavithermus (strain DSM 21510 / WK1)', 'fullName': 'Anoxybacillus flavithermus (strain DSM 21510 / WK1)'}"