"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7B7I0"	"{'domain_architectures': 26296, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26296}"	"['IF-3 binds to the 30S ribosomal subunit and shifts the equilibrium between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins']"	"infC"	"[{'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006413', 'name': 'translational initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B7B7I0_9BACT"	"0c9cb4d3ca1084faa12bc81ad6b09c7b36fd1fe0"	True	False	False	204	"Translation initiation factor IF-3"	3	""	"MKNDSLKEQYRINERIRVREVRLVGDNVEQGVYPTSQALKMAEDQGLDLVEISPNAAPPVCRITDYQKFLYQQKKRQKEQKAKSVKVIVKEIRFGPQTDDHDYNFKLKHAKGFLEEGAKVKAYVFFKGRSILFKEQGEVLLLRFANDLEEYGKVEQLPVLEGKRMIIMLTPKKAGAAATPKPAVSKPVVKKVVVTPKPKTEESE"	"unreviewed"	"{'taxId': '537006', 'scientificName': 'Parabacteroides johnsonii DSM 18315', 'fullName': 'Parabacteroides johnsonii DSM 18315'}"
