"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6YV24"	"{'domain_architectures': 6440, 'entries': 22, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 3, 'ssf': 2, 'cdd': 1, 'pfam': 2, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pirsf': 1, 'interpro': 9}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6440}"	"['Responsible for channeling the electrons from the oxidation of dihydroorotate from the FMN redox center in the PyrD type B subunit to the ultimate electron acceptor NAD(+)']"	"pyrK"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0050660', 'name': 'flavin adenine dinucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051537', 'name': '2 iron, 2 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006221', 'name': 'pyrimidine nucleotide biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B6YV24_THEON"	"515b30940682b2e2c813a561c155797c96c45d00"	True	False	False	233	"Probable dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit"	3	"UP000002727"	"MLERVKLKEVWKVARDVKAFRFERDFDFKAGQFIMAWLPGVGEKPFSLADRDLIVVKRVGPFTSRLFELDEGDYIWLRGPYGNGFEPKGEKIALVGGGIGLPPLYAFAKQNAGKFEKITLIYGAKTKEDLALMDIERYVDEIMVTTDDGSAGRKGFPTDVLAERKEEFDQIYACGPEPMLKAVLRIMDYRNVQVSAERYMKCGIGVCGNCALGPYLVCKDGPVFDGSKLMELL"	"unreviewed"	"{'taxId': '523850', 'scientificName': 'Thermococcus onnurineus (strain NA1)', 'fullName': 'Thermococcus onnurineus (strain NA1)'}"