"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6QT27"	"{'domain_architectures': 16386, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'profile': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16386}"	"['Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation']"	"PMAA_003910"	"[{'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006413', 'name': 'translational initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B6QT27_TALMQ"	"1c85f241b778189fd9a754044a87eb621166ad3c"	True	False	False	114	"SUI1 domain-containing protein"	3	"UP000001294"	"MSIENLKTFDPFAEADEDTGETKQSQNYIHIRIQQRNGRKTLTTVQGLPKKFDQKKILKVIKKKFACNGTIVNDSEMGEVIQLQGDQRKDVQEFLVDKKEGLELDAKTIKVHGF"	"unreviewed"	"{'taxId': '441960', 'scientificName': 'Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)', 'fullName': 'Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)'}"