"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6JBS5"	"{'domain_architectures': 3805, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3805}"	"[""Guanylyltransferase that catalyzes the activation of (2R)-3-phosphoglycerate (3PG) as 3-[(R)-glyceryl]-diphospho-5'-guanosine, via the condensation of 3PG with GTP. It is involved in the biosynthesis of a derivative of the hydride carrier cofactor coenzyme F420, 3PG-F420""]"	"fbiD"	"[{'identifier': 'GO:0043814', 'name': 'phospholactate guanylyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"FBID_AFIC5"	"15d8c4db3b86d47eaae5c57107b4946ad5c82d6c"	True	False	False	237	"3-phospho-D-glycerate guanylyltransferase"	3	"UP000007730"	"MARSDAFVILPVKAFVGAKSRLAPLLSVGERTMLARVMLNDVLDAAIAAVGPQSVSVVTSADDVADHARRAGVGVIDDEGARGTNAAVKVGFARIAARRRGAVLTLSSDIPGLIPSDIVALISAAERSRVALAPACDDGGTNALACDVVGRIPLCFGPGSFARHIAAANAADVRPAVLLNQRLGLDLDEPHHLMQFLDRGTSTQTDAYLRVLRLKERKGHSFVVAAQQATGARRLAV"	"reviewed"	"{'taxId': '504832', 'scientificName': 'Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)', 'fullName': 'Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)'}"