"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6I568"	"{'domain_architectures': 3960, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prints': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3960}"	"['Mediates the interaction of DNA replication initiator protein DnaA with DNA polymerase subunit beta sliding clamp (dnaN). Stimulates hydrolysis of ATP-DnaA to ADP-DnaA, rendering DnaA inactive for reinitiation, a process called regulatory inhibition of DnaA or RIDA (By similarity)']"	"hda"	"[{'identifier': 'GO:0032297', 'name': 'negative regulation of DNA-templated DNA replication initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"HDA_ECOSE"	"44032ada816e1f9e3432afe50b91752cf7856a7d"	True	False	False	233	"DnaA regulatory inactivator Hda"	3	""	"MNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIPFVKEILKL"	"reviewed"	"{'taxId': '409438', 'scientificName': 'Escherichia coli (strain SE11)', 'fullName': 'Escherichia coli (strain SE11)'}"
