"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5ZB20"	"{'domain_architectures': 28622, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 28622}"	"['This protein binds to 23S rRNA in the presence of protein L20']"	"rplU"	"[{'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RL21_UREU1"	"4b1c30883fa83d805b10604847bd18684a953458"	True	False	False	100	"Large ribosomal subunit protein bL21"	3	""	"MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGSVGTPFVKNAVVNATVLKQGKQKKINIIKFKSKKHHLKRQGHRQPYTQLVIDSISVK"	"reviewed"	"{'taxId': '565575', 'scientificName': 'Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)', 'fullName': 'Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)'}"
