"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5XE38"	"{'domain_architectures': 4628, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4628}"	"['Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site']"	"SPCS2"	"[{'identifier': 'GO:0006465', 'name': 'signal peptide processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005787', 'name': 'signal peptidase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B5XE38_SALSA"	"c77a7a23aba38fcdbd3dd11197dadfc688de5c94"	True	False	False	201	"Signal peptidase complex subunit 2"	2	"UP001652741"	"MAARNGKNGLLEKWRIDEKPVKIDKWDGAAVKNSLDDAAKKVLLEKYGYAENFNLVDGRLLICTISCLFAIVALIWDFLYPFPESKPVLAICVISYFIMMGILTLYTSYQEKNIFLVSVQKDPAGMDPDHTWQLSSSLKRFDDQYTLRVSFTDGKSKHTRVQEITKSVGAFFDGNGTLVMDQFEKCVSKLHDTLATEKKTK"	"unreviewed"	"{'taxId': '8030', 'scientificName': 'Salmo salar', 'fullName': 'Salmo salar (Atlantic salmon)'}"