General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5VLP3",
        "id": "B5VLP3_YEAS6",
        "source_organism": {
            "taxId": "545124",
            "scientificName": "Saccharomyces cerevisiae (strain AWRI1631)",
            "fullName": "Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)"
        },
        "name": "Diphthamide biosynthesis protein 4",
        "description": [
            "Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2"
        ],
        "length": 172,
        "sequence": "MSLVNSLTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVGGFHFSESLLDECIDNVDAMERSHSGYQLLTQCSACSLWLKVNFDIEEEQEGQ",
        "proteome": null,
        "gene": "AWRI1631_102810",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0017183",
                "name": "protein histidyl modification to diphthamide",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b6cb9d4859d34fbd10031d805ecbe5ce7d961f3f",
        "counters": {
            "domain_architectures": 2985,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 1,
                "cdd": 1,
                "pfam": 2,
                "profile": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2985
        }
    }
}