"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5RF82"	"{'domain_architectures': 30296, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'ncbifam': 3, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 30296}"	"['Globally modulates RNA abundance by binding to RNase E (Rne) and regulating its endonucleolytic activity. Can modulate Rne action in a substrate-dependent manner by altering the composition of the degradosome. Modulates RNA-binding and helicase activities of the degradosome']"	"rraA"	"[{'identifier': 'GO:0008428', 'name': 'ribonuclease inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051252', 'name': 'regulation of RNA metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RRAA_SALG2"	"7ba918e63a501c46e37074330479cf2ec61ab795"	True	False	False	161	"Regulator of ribonuclease activity A"	3	""	"MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGRVLLVDGGGSVRRALVDAELARLATQNEWEGLVIYGAVRQVDDLEELDIGIQAIAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"	"reviewed"	"{'taxId': '550538', 'scientificName': 'Salmonella gallinarum (strain 287/91 / NCTC 13346)', 'fullName': 'Salmonella gallinarum (strain 287/91 / NCTC 13346)'}"
