"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5QVK0"	"{'domain_architectures': 90812, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'ncbifam': 2, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 90812}"	"['Required for optimal enterobactin synthesis. Acts as a proofreading enzyme that prevents EntB misacylation by hydrolyzing the thioester bound existing between EntB and wrongly charged molecules']"	"entH"	"[{'identifier': 'GO:0016790', 'name': 'thiolester hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009239', 'name': 'enterobactin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"ENTH_SALEP"	"83515c55570f61cfb5e878ab31f7d2777385a86e"	True	False	137	"Proofreading thioesterase EntH"	3	""	"MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDEVLEAEMPVDARTHQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG"	"reviewed"	"{'taxId': '550537', 'scientificName': 'Salmonella enteritidis PT4 (strain P125109)', 'fullName': 'Salmonella enteritidis PT4 (strain P125109)'}"