"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5QUN2"	"{'domain_architectures': 18629, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 18629}"	"['Involved in the biogenesis of TorA. Acts on TorA before the insertion of the molybdenum cofactor and, as a result, probably favors a conformation of the apoenzyme that is competent for acquiring the cofactor']"	"torD"	"[{'identifier': 'GO:0051259', 'name': 'protein complex oligomerization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"TORD_SALEP"	"6a167cdf82ef9584e6d106088ccd950944c0d991"	True	False	False	210	"Chaperone protein TorD"	3	""	"MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKRQPALAASVALLEQKIAALSLRQDAQLELAADFCGLFLMTDKKSALPYASQYPQQEPGMIKHLLLEAGMEVNDDFKEPADHLAIYLELLSHLHFSLGESFQQRRMNKLRQKTLSSLLEWLPEFTNNCLKHDPYGFYAALSQLLLAIVRFDDGKEDLSIVAVE"	"reviewed"	"{'taxId': '550537', 'scientificName': 'Salmonella enteritidis PT4 (strain P125109)', 'fullName': 'Salmonella enteritidis PT4 (strain P125109)'}"