"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5H6F9"	"{'domain_architectures': 44311, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 2, 'pirsf': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 44311}"	"[""Catalyzes the formation of sulfite from adenosine 5'-phosphosulfate (APS) using thioredoxin as an electron donor""]"	"cysH"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004604', 'name': 'phosphoadenylyl-sulfate reductase (thioredoxin) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019379', 'name': 'sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B5H6F9_STRE2"	"7eeef8759c43c36f2f8a365b1ed067ea1b563441"	True	False	False	233	"Adenosine 5'-phosphosulfate reductase"	3	"UP000002805"	"MTTVQAERDLKSLAEQAGRDLEEASALEILKWATETFGPRFCVTSSMEDAVVAHLASRVLPGVDVVFLDTGYHFEETIGTRDAVDAVMDVNVITLTPRQSVAEQDAQYGPKLHDRDPDLCCALRKVKPLEDGLTAYDAWATGLRRDESPTRAGTPVVGWDEKRRKVKVSPIARWTQDDVDAYVAEHGVLTNPLLMDGYASVGCAPCTRRVLEGEDARAGRWAGRGKTECGLHG"	"unreviewed"	"{'taxId': '457429', 'scientificName': 'Streptomyces pristinaespiralis (strain ATCC 25486 / DSM 40338 / CBS 914.69 / JCM 4507 / KCC S-0507 / NBRC 13074 / NRRL 2958 / 5647)', 'fullName': 'Streptomyces pristinaespiralis (strain ATCC 25486 / DSM 40338 / CBS 914.69 / JCM 4507 / KCC S-0507 / NBRC 13074 / NRRL 2958 / 5647)'}"