"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5F5I6"	"{'domain_architectures': 16076, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 16076}"	"['Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division']"	"zapA"	""	"ZAPA_SALA4"	"c53cc3f60b50f86d6eaf925d526da9863fb8c89f"	True	False	False	109	"Cell division protein ZapA"	3	""	"MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKVRTRVTNTEQLVFIAALNISYELTQEKAKTRDYAASMEQRIRMLQQTIEQALLDQGRITEKTGQNFE"	"reviewed"	"{'taxId': '454166', 'scientificName': 'Salmonella agona (strain SL483)', 'fullName': 'Salmonella agona (strain SL483)'}"