"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5BKG4"	"{'domain_architectures': 2097, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2097}"	"['Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; fumarate reductase is used in anaerobic growth, and succinate dehydrogenase is used in aerobic growth. Anchors the catalytic components of the fumarate reductase complex to the cell inner membrane, binds quinones']"	"frdD"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0006106', 'name': 'fumarate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"FRDD_SALPK"	"6ceb25760b98104850ec292dcd574d958a721010"	True	False	False	119	"Fumarate reductase subunit D"	3	""	"MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFTQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL"	"reviewed"	"{'taxId': '554290', 'scientificName': 'Salmonella paratyphi A (strain AKU_12601)', 'fullName': 'Salmonella paratyphi A (strain AKU_12601)'}"
