"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5A989"	"{'domain_architectures': 1670, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1670}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"100174851"	""	"B5A989_BOMMO"	"76403b4fe60ff5d5267a2a2bbf7b2f37f785b8bc"	True	False	False	190	"NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial"	2	"UP000005204"	"MVSWSALGRSFGINLVKNSLKSPNKIQNVTFTTAKTLKGSHGERTMALQPSRWQWHKFKDMLHFYMMVGLIPAGALIFYCNVFIGPAQLTPIPEGYTPKYWEYHRHPITRFIARYIHNNPQQDYEKFMHFLDEEQQRIKLRALEKEIIKKMAERQDYQAYYYKPMVNKYLRMNKKTGDELYNRIGDDYKD"	"unreviewed"	"{'taxId': '7091', 'scientificName': 'Bombyx mori', 'fullName': 'Bombyx mori (Silk moth)'}"