"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4Y1U6"	"{'domain_architectures': 0, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"ndhC"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B4Y1U6_9CARY"	""	True	False	True	50	"NADH-ubiquinone oxidoreductase chain 3"	3	""	"MFILYEYDIFWAFLIISSVIPILAFLFSGILAPSSKGPEKLSSYESGIEP"	"unreviewed"	"{'taxId': '39867', 'scientificName': 'Silene atocioides', 'fullName': 'Silene atocioides'}"