HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4SP12",
"id": "RL21_STRM5",
"source_organism": {
"taxId": "391008",
"scientificName": "Stenotrophomonas maltophilia (strain R551-3)",
"fullName": "Stenotrophomonas maltophilia (strain R551-3)"
},
"name": "Large ribosomal subunit protein bL21",
"description": [
"This protein binds to 23S rRNA in the presence of protein L20"
],
"length": 105,
"sequence": "MYAVLVTGGKQYRVAQGEKLRIEKLEVEVGSEIKFDNILLLGDSDGIKIGDALSGAAVTATVLSQGRADKVRIIKFRRRKHHMKRQGHRQYYTEIEITGIAGGSK",
"proteome": null,
"gene": "rplU",
"go_terms": [
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b1c30883fa83d805b10604847bd18684a953458",
"counters": {
"domain_architectures": 28622,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28622
}
}
}