"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4QHU5"	"{'domain_architectures': 4806, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4806}"	"['Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation']"	"eIF3j"	"[{'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005852', 'name': 'eukaryotic translation initiation factor 3 complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"EIF3J_DROSI"	"68298d9205620ad7e8867b1ce92ada56e895b35e"	True	False	False	236	"Eukaryotic translation initiation factor 3 subunit J"	3	"UP000000304"	"MADDWESAADSDVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKPKPNKALKAKLEQQALREEEAEAERLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTSTCGGLDAFNPETKEEFKEFGATLSWKVAQFRESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEVLHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM"	"reviewed"	"{'taxId': '7240', 'scientificName': 'Drosophila simulans', 'fullName': 'Drosophila simulans (Fruit fly)'}"