"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4QA17"	"{'domain_architectures': 5872, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5872}"	"[""This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processivity during elongation of the leading strand""]"	"Dsim\GD21742"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006275', 'name': 'regulation of DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030337', 'name': 'DNA polymerase processivity factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B4QA17_DROSI"	"a97d7b10b1c940cf6f311b1cde9d20a761bdaed3"	True	False	False	255	"DNA sliding clamp PCNA"	3	"UP000000304"	"MLEARLSQTLLLKKIVDALKEIIAQGTLDCSDNGLELQSMDNSHVSLVALSLASDCFEKFHCDRNVSLGLDLKSLGKVLKCANSDDAVTIKAVDRPEKITLSFESDGKERTADYELKLLNLDQDHMEIPKKDYTCYIQLPSSEFARICRDMSMFDESLTIACSSKGIRFSAKGDLGTANIQLNAGTAMDVSIEVQEPVTQSFAGRYLNTFTKATPLADRVKLYLSEERPLLVEYPIEDYGHIRYYLAPKVNEPDF"	"unreviewed"	"{'taxId': '7240', 'scientificName': 'Drosophila simulans', 'fullName': 'Drosophila simulans (Fruit fly)'}"