GET /api/protein/UniProt/B4K0F6/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4K0F6",
        "id": "B4K0F6_DROGR",
        "source_organism": {
            "taxId": "7222",
            "scientificName": "Drosophila grimshawi",
            "fullName": "Drosophila grimshawi (Hawaiian fruit fly)"
        },
        "name": "Eukaryotic translation initiation factor 6",
        "description": [
            "Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May also be involved in ribosome biogenesis"
        ],
        "length": 245,
        "sequence": "MALRVQFENNDDVGVFSKLTNTYCLVAIGGSETFYSAYEAELAETIPVIHANIGGCRIIGRLTVGNRNGLLVPHSTTDEELQHLRNSLPDAVKIQRVEERLSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIAENTLVGSYTVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVNDWISFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEEMS",
        "proteome": "UP000001070",
        "gene": "eIF6",
        "go_terms": [
            {
                "identifier": "GO:0043022",
                "name": "ribosome binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042256",
                "name": "cytosolic ribosome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "8ac6a9139847722d5bca3b370d2864e1f85d42cd",
        "counters": {
            "domain_architectures": 4937,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4937
        }
    }
}