"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4I2P5"	"{'domain_architectures': 46530, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 46530}"	"[""Methyltransferase that can methylate proteins and, to a lower extent, arsenic. Catalytic subunit of a heterodimer with TRMT112, which monomethylates 'Lys-12' of histone H4 (H4K12me1), a modification present at the promoters of numerous genes encoding cell cycle regulators. Catalytic subunit of a heterodimer with TRMT112, which catalyzes N5-methylation of Glu residue of proteins with a Gly-Gln-Xaa-Xaa-Xaa-Arg motif. Methylates ETF1 on 'Gln-185'; ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May also play a role in the modulation of arsenic-induced toxicity by mediating the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. It however only plays a limited role in arsenic metabolism compared with AS3MT""]"	"Dsec\GM18204"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032259', 'name': 'methylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B4I2P5_DROSE"	"0d8b878601c6bceffbd1ea258abe6a468799d091"	True	False	False	224	"Methyltransferase HEMK2"	3	"UP000001292"	"METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPRLCVELGSGSGVIITALAKKLAGFSMCLATDINPKACNATRRTATRNGARLDSIRCSLADALRPRSVDVLLFNPPYVVTSDEELQTHQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFMERRIPGEHLCILKVTRCSASS"	"unreviewed"	"{'taxId': '7238', 'scientificName': 'Drosophila sechellia', 'fullName': 'Drosophila sechellia (Fruit fly)'}"