"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4F6Z7"	"{'domain_architectures': 70645, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70645}"	"[""Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA"", ""Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA""]"	"lsm5"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B4F6Z7_XENTR"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	False	91	"U6 snRNA-associated Sm-like protein LSm5"	2	"UP000008143"	"MAATVTPNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV"	"unreviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"