"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3TN56"	"{'domain_architectures': 65483, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 65483}"	"['NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient']"	"ndhC"	"[{'identifier': 'GO:0016651', 'name': 'oxidoreductase activity, acting on NAD(P)H', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NU3C_BRADI"	"e9a5b42e32de65bd6bc464b4186c01128f5abeb7"	True	False	False	120	"NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic"	3	"UP000008810"	"MFLLHEYDIFWTFLIIASLIPILAFWISGLLAPISEGPEKLSSYESGIEPMGGAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS"	"reviewed"	"{'taxId': '15368', 'scientificName': 'Brachypodium distachyon', 'fullName': 'Brachypodium distachyon (Purple false brome)'}"
