"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3QML1"	"{'domain_architectures': 30613, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30613}"	"['This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA']"	"dut"	"[{'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004170', 'name': 'dUTP diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006226', 'name': 'dUMP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046081', 'name': 'dUTP catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"DUT_CHLP8"	"5adb127e6bef47e972ed9845ea1b8804ddd1e9d6"	True	False	False	150	"Deoxyuridine 5'-triphosphate nucleotidohydrolase"	3	"UP000008811"	"MIKVKIVRLKEKASLPAYATAHAAGMDVSACLDAPVTLEPSSSALIPTGLAIELPEGYEAQLRPRSGLALRHLISLPNSPATIDADYRGEVGVILINHGREPFTVNHGDRIAQMVVSKVDRVAFEEVDSLSDTERGEGGFGHTGVASKAE"	"reviewed"	"{'taxId': '517417', 'scientificName': 'Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)', 'fullName': 'Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)'}"
