"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3PXY6"	"{'domain_architectures': 40308, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 40308}"	"['This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA']"	"accB"	"[{'identifier': 'GO:0003989', 'name': 'acetyl-CoA carboxylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006633', 'name': 'fatty acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009317', 'name': 'acetyl-CoA carboxylase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B3PXY6_RHIE6"	"dd0c5330318796f2fa156b62a4fc52353ee9b1f5"	True	False	False	157	"Biotin carboxyl carrier protein of acetyl-CoA carboxylase"	4	""	"MAEKKSGIDQALIRDLANILNETDLTEIEVEQDDLRIRVSRTGATQYVQAPIAAPAFAAPAAAAAPAAAGAAPAAPTRNPANVVNAPMVGTVYMAPAPGARPFIEIGATVKEGQTLIIIEAMKTMNQIPSPKSGKVTEILVDDGHPVEYGQALVVIE"	"unreviewed"	"{'taxId': '491916', 'scientificName': 'Rhizobium etli (strain CIAT 652)', 'fullName': 'Rhizobium etli (strain CIAT 652)'}"
