"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3JNU2"	"{'domain_architectures': 19697, 'entries': 22, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'profile': 2, 'pfam': 2, 'cdd': 1, 'pirsf': 1, 'hamap': 2, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 19697}"	"['Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. This allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration', 'Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration', 'Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX']"	"nnrE"	"[{'identifier': 'GO:0016836', 'name': 'hydro-lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0052855', 'name': 'ADP-dependent NAD(P)H-hydrate dehydratase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B3JNU2_9BACT"	"2d3cc4a65e0d282cab6625d9174661852f47cd75"	True	False	False	505	"Bifunctional NAD(P)H-hydrate repair enzyme"	3	""	"MKILSCTQQKQADAYTITQENILSINLMEKAASLLTDEICRRWDKSHRIIIFAGSGNNGGDAVAVARMLFLKNYTVEVYLFNITGVLSDDCMKNVQRLQECGFPNYHEISNSFDPPQLTKDDIVIDGLFGSGLNKPLSGGFASVVKYINASQATVVSIDLPSGLMGEDNSNNIRQNIIRADLTLSIQLPKLSFLFAENEDIVGEWKVLDIGISKNFIEEASTPYFITEANEIRQLIKPRSRFAHKGNFGHGLLIAGSYGMAGASILAARACLRSGIGLLTVHTPVRNHDIVQTSVPEAMVQNDVHELYFAEPVDLDNFQALAIGPGIGQEEETALATFDQLKECFIPLVLDADALNVFSTHRNYLNRIPKRTILTPHIGELERIIGRCNNSFERLTKAKELSAYLQCYIVLKGAYTVVITPEGNYYFNQTGNPGMATGGSGDVLTGIILALLSQGYSQENACRIAVYVHGLAGDIARNRVGEISLTAGDIIEALPEAWKNITETK"	"unreviewed"	"{'taxId': '470145', 'scientificName': 'Phocaeicola coprocola DSM 17136', 'fullName': 'Phocaeicola coprocola DSM 17136'}"
