"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3H2D0"	"{'domain_architectures': 3139, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3139}"	"['Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export']"	"napD"	""	"B3H2D0_ACTP7"	"cf776605ff36c65548fdc5ce6bdd33b93d45d007"	True	False	False	89	"Chaperone NapD"	3	""	"MSTENLNEAKNWYVCSLVVQAKPAKLAQVKADILTIPFAEIHGEKAEEGKLVVTLESDRQLALADLIDQVKDIDGVIVVLLISNYLDEQ"	"unreviewed"	"{'taxId': '537457', 'scientificName': 'Actinobacillus pleuropneumoniae serotype 7 (strain AP76)', 'fullName': 'Actinobacillus pleuropneumoniae serotype 7 (strain AP76)'}"
