"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2RM84"	"{'domain_architectures': 5123, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5123}"	"['CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA)']"	"PGN_1961"	""	"B2RM84_PORG3"	"f980e61197085d6693c5a00d099f0b8e937e8c9f"	True	False	False	169	"CRISPR-associated exonuclease Cas4"	3	""	"MIITGTHFNYHQVCRRKLWLFSAGITMEHTSDLVYEGKLIHETTYQQRPERYQELELDGIKIDFYDAKNRVVHEVKKSNKISPAHRLQLLYYLYVLERNGVLGATGILEYPTLRKKEEVILSDIDRERIREIEQEILQIISHEDCPPVIDSGICKNCSYYEFCFSGEEQ"	"unreviewed"	"{'taxId': '431947', 'scientificName': 'Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)', 'fullName': 'Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)'}"
