"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2RKR8"	"{'domain_architectures': 31871, 'entries': 23, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'smart': 1, 'ssf': 2, 'pfam': 2, 'profile': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prints': 3, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 31871}"	"['Small subunit of the glutamine-dependent carbamoyl phosphate synthetase (CPSase). CPSase catalyzes the formation of carbamoyl phosphate from the ammonia moiety of glutamine, carbonate, and phosphate donated by ATP, constituting the first step of 2 biosynthetic pathways, one leading to arginine and/or urea and the other to pyrimidine nucleotides. The small subunit (glutamine amidotransferase) binds and cleaves glutamine to supply the large subunit with the substrate ammonia']"	"carA"	"[{'identifier': 'GO:0004088', 'name': 'carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006207', 'name': ""'de novo' pyrimidine nucleobase biosynthetic process"", 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006541', 'name': 'glutamine metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B2RKR8_PORG3"	"ca8d55c21f73d160cbeb47ce92e2ac93ab15d9c4"	True	False	False	357	"Carbamoyl phosphate synthase small chain"	3	""	"MREQRKATLILDDGSRFEGYSFGCERAVAGEVVFNTAMTGYVESLTDPSYRGQIMVMTYPLVGNYGVPMKAAEPNGVSCFMESDRIHMEGIVVSDYSHSYSHWNAVESLGDWLKREQVFGLTGIDTRALAKHLREHGSMKGKIILEGGEDIVFADPYTVNQVAEASCREVIVYGTGSKKVVLVDCGVKDNIIRSLLREDITLYRVPWDYDFHRIAYDGLFISNGPGDPNMCSVTVEHIRRAVAGDKPICGICMGNQLLAKAAGASIFKLKYGHRSHNQPVREVGTNKCYITSQNHGFAVDPASLGSDWEELYINLNDGTNEGIRHKSKPFFSAQFHPEACGGPVDTMFIFDEFLKNL"	"unreviewed"	"{'taxId': '431947', 'scientificName': 'Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)', 'fullName': 'Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)'}"
