"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2GPU0"	"{'domain_architectures': 6098, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 3, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6098}"	"['Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity']"	"atp6v1c1a"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033180', 'name': 'proton-transporting V-type ATPase, V1 domain', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0046961', 'name': 'proton-transporting ATPase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B2GPU0_DANRE"	"04f9902a7715d7f73dd6d34508199823ece24c08"	True	False	False	383	"V-type proton ATPase subunit C"	2	""	"MTEFWLISAPGEKTCQQTWDKLMTATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITLLVVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLNLSQQEYYPYVYYKIDCNLLDFK"	"unreviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"
