"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2FT27"	"{'domain_architectures': 16076, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16076}"	"['Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division']"	"Smlt3865"	""	"B2FT27_STRMK"	"c53cc3f60b50f86d6eaf925d526da9863fb8c89f"	True	False	False	98	"Cell division protein ZapA"	3	"UP000008840"	"MSAEPVSVRILDREYTVGVGGDERDSLMAAARLLDARMREIRGSNRMAAVDRVAVLAALNLAHELQLLRDENARQAVALQQTLADLNRRLDRAIDGTP"	"unreviewed"	"{'taxId': '522373', 'scientificName': 'Stenotrophomonas maltophilia (strain K279a)', 'fullName': 'Stenotrophomonas maltophilia (strain K279a)'}"
