"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1X9B6"	"{'domain_architectures': 86430, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 86430}"	"['Associates with aggregated proteins, together with IbpA, to stabilize and protect them from irreversible denaturation and extensive proteolysis during heat shock and oxidative stress. Aggregated proteins bound to the IbpAB complex are more efficiently refolded and reactivated by the ATP-dependent chaperone systems ClpB and DnaK/DnaJ/GrpE. Its activity is ATP-independent']"	"ibpB"	""	"IBPB_ECODH"	"1a49c7cd006c7b597e6e0f45e18cc046e51a1431"	True	False	False	142	"Small heat shock protein IbpB"	3	""	"MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPIAAQRIAISERPALNS"	"reviewed"	"{'taxId': '316385', 'scientificName': 'Escherichia coli (strain K12 / DH10B)', 'fullName': 'Escherichia coli (strain K12 / DH10B)'}"