"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1LUN5"	"{'domain_architectures': 35959, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 3, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 35959}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"nuoC"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016651', 'name': 'oxidoreductase activity, acting on NAD(P)H', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NUOC_METRJ"	"a773b7c7baaff38b6179f5153d2849f261faa1a6"	True	False	False	215	"NADH-quinone oxidoreductase subunit C"	3	""	"MTNGISILPHTQPVYGDAAVAAMAERVVGALGPAVVSHAIAFGELTLVVQASDIVYALTYLRDDPACAFRNFIDICGVDYPQREKRFDVVYHLLSLRHNLRIRLKVQTDEVTPVPSVIEVFPAANWYERETYDLYGILFSGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDQARVVYEPVQLTQEFRNFDFLSPWEGTDYVLPGDEKTSA"	"reviewed"	"{'taxId': '426355', 'scientificName': 'Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)', 'fullName': 'Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)'}"
