"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1IME3"	"{'domain_architectures': 136430, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 5, 'panther': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 136430}"	"['Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis']"	"apt"	"[{'identifier': 'GO:0003999', 'name': 'adenine phosphoribosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006168', 'name': 'adenine salvage', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"APT_CLOBK"	"0f8ac38f062a402c09070bf5cbec330fb03fbefd"	True	False	False	172	"Adenine phosphoribosyltransferase"	3	""	"MNLKEHIRVIENFPKEGISFKDVTTILQDGKVLNYTIDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEYGQDELQIHKDSIKKGDKVAIVDDLLATGGTIASVVKLVEELGGEVVNVSFVIELTDLKGKDKLEGYDINSLVQYNI"	"reviewed"	"{'taxId': '498213', 'scientificName': 'Clostridium botulinum (strain Okra / Type B1)', 'fullName': 'Clostridium botulinum (strain Okra / Type B1)'}"
