"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B0XQ96"	"{'domain_architectures': 291149, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'prosite': 2, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 291149}"	"['Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway']"	"AFUB_009190"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B0XQ96_ASPFC"	"e96b765c85e65c75beacfc1efe2818f689e0515d"	True	False	False	310	"Probable NAD(P)H-dependent D-xylose reductase xyl1"	3	"UP000001699"	"MTKFKLNTGAEIPAIGFGTWQDEHAQEDAVVEALKVGYRHIDTARVYLTEKAVGRAIKKSGVPREELFVTTKLWNNKHHPDDVEGALDASLADLQLDYVDLYLIHWPVAWKRGDDLFPKENGKYVLEDIDFVDTYKAMEKLLSTGKTKAIGVSNFSKAEMERLVQNTSVVPAVHQLEGHPWLQQRSFVDWHKSKGIHVTHYSPFGNQNEIYSSKVQIGKLIDEPVLAEIGKKYNKSSAQVALAWGVTQGHSVLPKSKTPSRIKANLEGDFHLSDEDMKKIQGIDKKLRFNDSSADFGRDFFTDLEGKGSV"	"unreviewed"	"{'taxId': '451804', 'scientificName': 'Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)', 'fullName': 'Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)'}"
