"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B0KNU2"	"{'domain_architectures': 11798, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ncbifam': 2, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 11798}"	"['Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex']"	"kdpC"	"[{'identifier': 'GO:0008556', 'name': 'P-type potassium transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006813', 'name': 'potassium ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"KDPC_PSEPG"	"37300587b18534ff9dc0f21fbf8387796c0f23f1"	True	False	False	183	"Potassium-transporting ATPase KdpC subunit"	3	""	"MNAYVRPALSLALLMTLLTGVLYPLAVTGVAQVAFPNQANGSLVRDEHGQVRGSALIAQDFQGDGWFHSRPSAGAYATVASSASNLSPSNPALAERVKGDAATLFQAQQGPVPQALLTTSGSGLDPHLPPEAVAYQIPRVAAARQLPVERLQALQEEATLHPLIGPPVVNVLALNQKIEQLSH"	"reviewed"	"{'taxId': '76869', 'scientificName': 'Pseudomonas putida (strain GB-1)', 'fullName': 'Pseudomonas putida (strain GB-1)'}"