"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9Z0M4"	"{'domain_architectures': 5699, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5699}"	"['Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell']"	"RPL36"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A9Z0M4_ONCMA"	"06201cbcd76da6d1bf714ec057f2ac1f90c0a1a4"	True	False	False	105	"60S ribosomal protein L36"	2	""	"MAIRYPMAVGLSKGHPVTKNVTAPKHARRRGRLTKHSKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVLAAMRKAAAKKD"	"unreviewed"	"{'taxId': '173242', 'scientificName': 'Oncorhynchus masou formosanus', 'fullName': 'Oncorhynchus masou formosanus (Formosan land-locked salmon)'}"