"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9R923"	"{'domain_architectures': 21782, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'ncbifam': 3, 'panther': 1, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21782}"	"['Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell']"	"mscL"	"[{'identifier': 'GO:0008381', 'name': 'mechanosensitive monoatomic ion channel activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0034220', 'name': 'monoatomic ion transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"MSCL_YERPG"	"6f99e8018eaa5607dc65dc2829aed0b45775c497"	True	False	False	137	"Large-conductance mechanosensitive channel"	3	""	"MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"	"reviewed"	"{'taxId': '349746', 'scientificName': 'Yersinia pestis bv. Antiqua (strain Angola)', 'fullName': 'Yersinia pestis bv. Antiqua (strain Angola)'}"
