"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9MT08"	"{'domain_architectures': 4225, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 2, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4225}"	"['Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions']"	"tusB"	"[{'identifier': 'GO:0002143', 'name': 'tRNA wobble position uridine thiolation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"TUSB_SALPB"	"24690c31e06ef878f71c5b136686b0ff1eb30318"	True	False	False	95	"Protein TusB"	3	""	"MLHTLPHCASGVDFPALLRLLKEGDALLLLQDGVTVAIEGNRFLESLRDAPITVYALKEDIDARGLGGQISDSVVRVDYTEFVRLTVKYANQMAW"	"reviewed"	"{'taxId': '1016998', 'scientificName': 'Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)', 'fullName': 'Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)'}"
