"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9MIS0"	"{'domain_architectures': 62699, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'pirsf': 1, 'prints': 1, 'prosite': 2, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 62699}"	"['During stationary phase, binds the chromosome non-specifically, forming a highly ordered and stable dps-DNA co-crystal within which chromosomal DNA is condensed and protected from diverse damages. It protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral, which can be released after reduction. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction']"	"dps"	"[{'identifier': 'GO:0008199', 'name': 'ferric iron binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016722', 'name': 'oxidoreductase activity, acting on metal ions', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"DPS_SALAR"	"cec8b804a2b695828936e90d7cf5ad612fb951b2"	True	False	False	167	"DNA protection during starvation protein"	3	"UP000002084"	"MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRAALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE"	"reviewed"	"{'taxId': '41514', 'scientificName': 'Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)', 'fullName': 'Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)'}"