"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9KWY1"	"{'domain_architectures': 88335, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'smart': 1, 'pfam': 1, 'profile': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 88335}"	"['Transferase that catalyzes the transfer of sulfur from thiosulfate to thiophilic acceptors such as cyanide or dithiols. May function in a CysM-independent thiosulfate assimilation pathway by catalyzing the conversion of thiosulfate to sulfite, which can then be used for L-cysteine biosynthesis']"	"glpE"	"[{'identifier': 'GO:0004792', 'name': 'thiosulfate-cyanide sulfurtransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A9KWY1_SHEB9"	"d8b07c182f65aef6466cd58366a63f75051d79b8"	True	False	False	101	"Thiosulfate sulfurtransferase GlpE"	3	""	"MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNNENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCEQGFDDVYSLDGGYSAWHEANA"	"unreviewed"	"{'taxId': '399599', 'scientificName': 'Shewanella baltica (strain OS195)', 'fullName': 'Shewanella baltica (strain OS195)'}"