"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9BHU3"	"{'domain_architectures': 35208, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 2, 'cathgene3d': 2, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 35208}"	"[""Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosphorylation on 2'-hydroxyl of the adenosine moiety of NAD to yield NADP""]"	"nadK"	"[{'identifier': 'GO:0006741', 'name': 'NADP+ biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0019674', 'name': 'NAD+ metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"NADK_PETMO"	"6dbe0777d1dd1f485df8c8f35d32e1628c1f7845"	True	False	False	274	"NAD kinase"	3	"UP000000789"	"MKIFIFYNPLKLSNDDLEENILKPFNESNIEVIGYAAAGSTVEEKQAQVADFFVIFGGDGTVLKIAEIAAIFSKPVIAVNTGNLGFLSSYSSSEIKELIEDIQKENISFSFRHLLECHVGTKKVVVLNDIVLLKSQPLGTMNVDVKIEEHTLFSFAGDGLIVSTPTGSTAYALSAGGPIIHPELNVVQLIPLAAHALNIRPFIAPPTQRIEIILKNMSKGFVYVTGDGDIIHRMEPGMSIFVTSSEMTIKLAQRNGNNYLNALDKKLGFGRRFE"	"reviewed"	"{'taxId': '403833', 'scientificName': 'Petrotoga mobilis (strain DSM 10674 / SJ95)', 'fullName': 'Petrotoga mobilis (strain DSM 10674 / SJ95)'}"
