"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8ZRQ3"	"{'domain_architectures': 29281, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29281}"	"['Binds together with bS18 to 16S ribosomal RNA']"	"rpsF"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RS6_DESOH"	"d4dcde418b00f9f7e17b5827263519d23503c2b8"	True	False	False	168	"Small ribosomal subunit protein bS6"	3	"UP000008561"	"MRRYETIFIADPDLSPENQAQLFEKATTLIDANSGVLVEFDEWGTRRLAYEIRKKPRGHYVRLDFCGDGATVQGLENAFRIDERVLKFMTVFLSENADPEALRQAIAEEKEKKAEGQAAADAAPADGDDEAPKQPAPASDDDAPKQPETEAGSDETEAAAADKSDDNA"	"reviewed"	"{'taxId': '96561', 'scientificName': 'Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)', 'fullName': 'Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)'}"
